$185.00
Short thymosin‑β4 motif linked to actin binding, cell migration and angiogenesis. Potential benefits include support for soft‑tissue repair and reduced inflammation in ocular/dermal models. Composition isn’t standardized across suppliers; human clinical data are minimal.
Description
TB‑500 (Thymosin β4 Fragment 17–23) is a research name commonly used for a short peptide fragment derived from thymosin β4 (Tβ4), a 43‑amino‑acid actin‑binding protein involved in cell migration and tissue repair. The most frequently referenced TB‑500 form corresponds to the Tβ4 residues 17–23 sequence, often with N‑terminal acetylation. This fragment lies within the Tβ4 actin‑binding region and has been studied for pro‑migratory, pro‑angiogenic, and anti‑inflammatory actions in preclinical models.
Chemical Structure / Identifiers
| Property | Detail |
| Common Name | TB‑500; Tβ4 17–23 fragment |
| Parent Protein | Thymosin β4 (TMSB4X), 43 aa |
| Parent Sequence (human Tβ4) | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| TB‑500 Fragment Sequence | Leu‑Lys‑Lys‑Thr‑Glu‑Thr‑Gln (LKKTETQ); frequently N‑acetylated at the N‑terminus |
| Standardization Note | TB‑500 is a research nickname; exact sequence/termini may vary by source or salt form |
| Selected Registry/DB | NCATS GSRS lists TB‑500 as N‑Acetyl‑Leu‑Lys‑Lys‑Thr‑Glu‑Thr‑Gln (Tβ4 17–23) |
Primary Research Focus
• Tissue repair and regeneration: enhances cell migration and wound closure; promotes angiogenesis in preclinical models.
• Actin dynamics: fragment maps to the actin‑binding motif of Tβ4, supporting cytoskeletal remodeling during repair.
• Anti‑inflammatory activity: reductions in pro‑inflammatory signaling reported in ocular and mucosal injury models.
• Cardiovascular/ischemia models (parent Tβ4): parent protein shown to aid myocardial repair and endothelial function; fragment investigated as a minimal active domain.
Safety / Limitations
• Research Use Only; not approved for medical use. Human clinical data for TB‑500 are limited.
• “TB‑500” is not a single standardized entity; sequences and terminal modifications may differ by supplier.
• Quality and identity can vary across sources; verify sequence/analysis certificates for any study material.
• Some sports anti‑doping bodies consider Tβ4/TB‑500 prohibited; consult current regulations for research in athletics contexts.
Key Publications / References
NCATS GSRS substance record: TB‑500 (N‑Acetyl‑Leu‑Lys‑Lys‑Thr‑Glu‑Thr‑Gln; Tβ4 17–23). https://gsrs.ncats.nih.gov/ginas/app/ui/substances/e850a4ce-7777-4d25-ae69-ab7174c798a4
PubChem Compound Summary: Thymosin β4 (also listed as timbetasin). https://pubchem.ncbi.nlm.nih.gov/compound/Thymosin-beta4
Wikipedia (overview, sequence, actin binding, INN timbetasin). https://en.wikipedia.org/wiki/Thymosin_beta-4
Review (2021): Progress on the Function and Application of Thymosin β4. PMC: https://pmc.ncbi.nlm.nih.gov/articles/PMC8724243/
Ocular/corneal wound healing with Tβ4: Sosne et al., review. https://europepmc.org/article/med/20536468
Palatal wound healing study in rats with Tβ4: Zhu et al., 2014. https://www.spandidos-publications.com/10.3892/ijmm.2014.1832
Reviews
There are no reviews yet.